Loading...
Statistics
Advertisement

Next Pub
www.nextpub.com.br/

Nextpub.com.br

Advertisement
Nextpub.com.br is hosted in United States / Houston . Nextpub.com.br uses HTTPS protocol. Number of used technologies: 10. First technologies: CSS, Flexslider, Font Awesome, Number of used javascripts: 33. First javascripts: Jquery.min.js, Jquery-noconflict.js, Jquery-migrate.min.js, Number of used analytics tools: 0. Number of used plugins, modules: 4. Its server type is: nginx/1.10.1. Its CMS is: Joomla.

Technologies in use by Nextpub.com.br

Technology

Number of occurences: 10
  • CSS
  • Flexslider
  • Font Awesome
  • Html
  • Html5
  • Javascript
  • jQuery Colorbox
  • jQuery Hover Intent
  • jQuery UI
  • Php

Advertisement

Javascripts

Number of occurences: 33
  • jquery.min.js
  • jquery-noconflict.js
  • jquery-migrate.min.js
  • caption.js
  • jquery.touchSwipe.min.js
  • jquery.colorbox-min.js
  • script.min.js
  • bootstrap.min.js
  • modernizr.custom.26633.js
  • jquery.nyroModal.custom.min.js
  • jquery.sticky.js
  • scroll.js
  • jquery.gridrotator.js
  • instafeed.js
  • main.js
  • mootools-core.js
  • core.js
  • punycode.js
  • validate.js
  • namespace.js
  • eg-compressed.js
  • owl.carousel.min.js
  • script.js
  • jquery.flexslider.js
  • jquery.mousewheel.js
  • jquery.fitvids.js
  • favslider.js
  • viewportchecker.js
  • sp-smart-slider.js
  • jquery.mobile-1.0rc2.customized.min.js
  • jquery.easing.1.3.js
  • jquery.hoverIntent.minified.js
  • diapo.js

Content Management System

Number of occurences: 1
  • Joomla

Server Type

  • nginx/1.10.1

Social

Number of occurences: 1
  • Facebook Box

Used plugins, modules

Number of plugins and modules: 4
  • mod agenda slide
  • mod favslider
  • mod sp smart slider
  • mod clean nivo slider

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Nextpub.com.br

SSL certificate

    • name: /OU=Domain Control Validated/OU=Hosted by HostGator.com, LLC./OU=PositiveSSL Wildcard/CN=*.hostgator.com.br
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: Hosted by HostGator.com, LLC.
        • 2: PositiveSSL Wildcard
      • CN: *.hostgator.com.br
    • hash: 6e78c727
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 124396998990437166508958247130372295581
    • validFrom: 151016000000Z
    • validTo: 181015235959Z
    • validFrom_time_t: 1444953600
    • validTo_time_t: 1539647999
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: D3:37:9C:5C:A7:7C:E2:69:72:87:18:2F:BD:85:2D:80:B0:7E:75:33
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.hostgator.com.br, DNS:hostgator.com.br

Meta - Nextpub.com.br

Number of occurences: 3
  • Name:
    Content: text/html; charset=utf-8
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: generator
    Content: Joomla! - Open Source Content Management

Server / Hosting

  • IP: 192.185.223.124
  • Latitude: 29.83
  • Longitude: -95.47
  • Country: United States
  • City: Houston

Rname

  • ns301.hostgator.com.br
  • ns300.hostgator.com.br
  • nextpub.com.br

Target

  • danielpaz.weboption.com.br

HTTP Header Response

HTTP/1.1 200 OK Server: nginx/1.10.1 Date: Mon, 08 Aug 2016 11:12:58 GMT Content-Type: text/html; charset=utf-8 Expires: Wed, 17 Aug 2005 00:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: 3baa15b3e10a3c8ced5fc6282e7c9c26=11d098a3b456516c9df90aa31e819c36; path=/; HttpOnly Last-Modified: Mon, 08 Aug 2016 11:12:58 GMT X-Cache: MISS from s_fl343 X-Cache-Lookup: MISS from s_fl343:80 Transfer-Encoding: chunked Via: 1.1 s_fl343 (squid/3.5.9) Connection: keep-alive

DNS

host: nextpub.com.br
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 192.185.223.124
host: nextpub.com.br
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns301.hostgator.com.br
host: nextpub.com.br
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns300.hostgator.com.br
host: nextpub.com.br
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns300.hostgator.com.br
  5. rname: danielpaz.weboption.com.br
  6. serial: 2016012900
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: nextpub.com.br
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: nextpub.com.br
host: nextpub.com.br
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 a mx include:websitewelcome.com ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.extpub.com.br, www.nnextpub.com.br, www.nextpub.com.br, www.nhextpub.com.br, www.hextpub.com.br, www.njextpub.com.br, www.jextpub.com.br, www.nkextpub.com.br, www.kextpub.com.br, www.nlextpub.com.br, www.lextpub.com.br, www.n extpub.com.br, www. extpub.com.br, www.nxtpub.com.br, www.nexxtpub.com.br, www.nxxtpub.com.br, www.nesxtpub.com.br, www.nsxtpub.com.br, www.newxtpub.com.br, www.nwxtpub.com.br, www.nerxtpub.com.br, www.nrxtpub.com.br, www.nefxtpub.com.br, www.nfxtpub.com.br, www.nevxtpub.com.br, www.nvxtpub.com.br, www.necxtpub.com.br, www.ncxtpub.com.br, www.neqxtpub.com.br, www.nqxtpub.com.br, www.neaxtpub.com.br, www.naxtpub.com.br, www.neyxtpub.com.br, www.nyxtpub.com.br, www.netpub.com.br, www.nexqtpub.com.br, www.neqtpub.com.br, www.nextpub.com.br, www.netpub.com.br, www.nexatpub.com.br, www.neatpub.com.br, www.nexstpub.com.br, www.nestpub.com.br, www.nexdtpub.com.br, www.nedtpub.com.br, www.nexetpub.com.br, www.neetpub.com.br, www.nexpub.com.br, www.nextqpub.com.br, www.nexqpub.com.br, www.nextapub.com.br, www.nexapub.com.br, www.next pub.com.br, www.nex pub.com.br, www.nextwpub.com.br, www.nexwpub.com.br, www.nextepub.com.br, www.nexepub.com.br, www.nextzpub.com.br, www.nexzpub.com.br, www.nextxpub.com.br, www.nexxpub.com.br, www.nextcpub.com.br, www.nexcpub.com.br, www.nextub.com.br, www.nextpiub.com.br, www.nextiub.com.br, www.nextpkub.com.br, www.nextkub.com.br, www.nextpuub.com.br, www.nextuub.com.br, www.nextpjub.com.br, www.nextjub.com.br, www.nextplub.com.br, www.nextlub.com.br, www.nextpb.com.br, www.nextpuwb.com.br, www.nextpwb.com.br, www.nextpueb.com.br, www.nextpeb.com.br, www.nextpusb.com.br, www.nextpsb.com.br, www.nextpuab.com.br, www.nextpab.com.br, www.nextpu.com.br, www.nextpubq.com.br, www.nextpuq.com.br, www.nextpubw.com.br, www.nextpuw.com.br, www.nextpubz.com.br, www.nextpuz.com.br, www.nextpubx.com.br, www.nextpux.com.br, www.nextpub.com.br, www.nextpu.com.br, www.nextpubs.com.br, www.nextpus.com.br, www.nextpuby.com.br, www.nextpuy.com.br, www.nextpube.com.br, www.nextpue.com.br, www.nextpubd.com.br, www.nextpud.com.br, www.nextpubc.com.br, www.nextpuc.com.br,

Other websites we recently analyzed

  1. 辽化教育基金
    Hangzhou (China) - 121.42.112.1
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 5
    Number of meta tags: 3
  2. 首页-深圳市凯利盈科技有限公司
    首页
    Central District (Hong Kong) - 113.10.244.56
    Server software: Microsoft-IIS/6.0
    Technology: CSS, Html, Javascript, jQuery, Php
    Number of Javascript: 10
    Number of meta tags: 4
  3. supremelogisticsllc.com
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  4. apztec Support
    Ashburn (United States) - 54.88.230.97
    Server software: nginx/1.11.3
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 3
    Number of meta tags: 1
  5. rosanne.
    San Francisco (United States) - 192.0.78.24
    Server software: nginx
    Technology: CSS, Google Font API, Gravatar, Html, Html5, Javascript, Php, Pingback, Shortcodes, SVG, comScore, Wordpress
    Number of Javascript: 6
    Number of meta tags: 9
  6. Fotos
    Dallas (United States) - 67.228.150.34
    Server software: Microsoft-IIS/7.5
    Technology: Html
    Number of meta tags: 1
  7. pennsylvaniamalpracticelawyers.info
    Scottsdale (United States) - 50.63.202.62
    Server software:
    Technology: Html, Html5, Iframe
  8. Pet Kraft
    United States - 208.91.199.87
    Server software: Apache Phusion_Passenger/4.0.10 mod_bwlimited/1.4 mod_fcgid/2.3.9
    Technology: CSS, Html, Javascript, jQuery, Php
    Number of Javascript: 8
    Number of meta tags: 1
  9. califoncoffee.com
    Scottsdale (United States) - 184.168.221.61
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  10. donateordance.net
    Scottsdale (United States) - 184.168.221.63
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe

Check Other Websites